DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl6

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001334173.1 Gene:Arl6 / 56297 MGIID:1927136 Length:193 Species:Mus musculus


Alignment Length:178 Identity:60/178 - (33%)
Similarity:102/178 - (57%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFLTVLK-KMRQKEREMRILLLGLDNAGKTTI---LKRFNGEPIDTISPTLGFNIKTLEHNGYT 61
            ||.|..|. .:..|::|:.:|.|||||:|||||   ||..|.:..| |.||:||:|:..:.:..:
Mouse     1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQD-IVPTIGFSIEKFKSSSLS 64

  Fly    62 LNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVL--C 124
            ..::|:.||...|:.|.:|::....:::|:||:|::|:....:||..||....:....:.:|  .
Mouse    65 FTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFA 129

  Fly   125 NKQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            ||.||..:::|.::.::|.||.|....|.:....|:.||.|...:|||
Mouse   130 NKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 58/176 (33%)
Arl6NP_001334173.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.