DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl14

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001093453.1 Gene:arl14 / 556921 ZFINID:ZDB-GENE-070705-288 Length:201 Species:Danio rerio


Alignment Length:157 Identity:67/157 - (42%)
Similarity:100/157 - (63%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLE----HNGYTLNMWDVGGQKSLRS 75
            |.||||||||||||:|:|.:.. .|...|: ||:|||::.:|    .:..:|.:||||||..:|:
Zfish    11 EARILLLGLDNAGKSTLLYKLKYDENFHTV-PTIGFNVEMIEAKKNRDKISLTVWDVGGQAKMRA 74

  Fly    76 YWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKE 140
            :|||:::.|.|:|:||||:|..||:.....|:..|:.|.|.|..::||.||||:.||.:..||.|
Zfish    75 FWRNFYQDTAGIVFVVDSSDVKRLDEAKGVLEQSLRSEHLRGLPVVVLANKQDIVGAATVTEITE 139

  Fly   141 ILHL-EDITTHHWLVAGVSAVTGEKLL 166
            ..:| :..:...|.:...||:||..|:
Zfish   140 QFNLRKSCSDRDWFIQPCSALTGAGLV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 67/157 (43%)
arl14NP_001093453.1 P-loop containing Nucleoside Triphosphate Hydrolases 13..175 CDD:476819 66/155 (43%)

Return to query results.
Submit another query.