DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arf4b

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001017707.1 Gene:arf4b / 550402 ZFINID:ZDB-GENE-050417-205 Length:180 Species:Danio rerio


Alignment Length:168 Identity:77/168 - (45%)
Similarity:117/168 - (69%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSY 76
            :::|||:|::|||.|||||:|.:.. ||.:.|| ||||||::|:|:...:..:||||||..:|..
Zfish    14 EKKEMRLLMVGLDAAGKTTVLYKLKLGEVVTTI-PTLGFNVETVEYRNISFTVWDVGGQDIIRRL 77

  Fly    77 WRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEI 141
            ||:|:::|.||::||||:||.|:|:..:||:::|.|:.:..|.||||.||||||.|::::|:.|.
Zfish    78 WRHYYQNTKGLIFVVDSSDRDRIETAAEELKMMLAEDEMRDAVLLVLANKQDLPKAMAAHELTER 142

  Fly   142 LHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            |.|..:....|.|....||.|..|...:|||...::||
Zfish   143 LGLHALRGRQWFVQSTCAVQGSGLYEGLDWLTDQLSKR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 75/162 (46%)
arf4bNP_001017707.1 P-loop_NTPase 1..180 CDD:304359 75/166 (45%)
SAR 15..174 CDD:197556 74/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.