DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl11l.1

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001005103.1 Gene:arl11l.1 / 448682 XenbaseID:XB-GENE-5813137 Length:188 Species:Xenopus tropicalis


Alignment Length:184 Identity:77/184 - (41%)
Similarity:114/184 - (61%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG--FLTVLKK-MRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEH-NGY 60
            ||  |.|:.|. |.....:.:|::||||.|||||:|.:.. .|.:.|| ||:|||::|:|. ...
 Frog     1 MGLLFSTLYKALMGFSGTKAKIIMLGLDAAGKTTVLYKLKLNETVCTI-PTIGFNVETVEPIRNV 64

  Fly    61 TLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCN 125
            :..:||||||:.:|:.|::||.:|||||:||||||..|.:....||:.:|..:.:.|...||:.|
 Frog    65 SFTVWDVGGQERIRALWKHYFVNTDGLVFVVDSADWERFKEASLELESILDNDEMRGVPFLVMAN 129

  Fly   126 KQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            |||||||....|:.|.|.|..|..|.|.|.|..|.||:.|:..:: ::.::.|:
 Frog   130 KQDLPGARRPMEVAEELGLMKIQGHQWHVQGCCAATGDGLVEGLE-VLTNLVKQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 74/174 (43%)
arl11l.1NP_001005103.1 Arf_Arl 21..179 CDD:206644 70/159 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.