DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl4

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:147 Identity:53/147 - (36%)
Similarity:84/147 - (57%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLE-----HNGYTLNMW 65
            :|..:..:...:.:::||||:|||||.|.|...:......||:|||.:.::     ..|....:|
  Fly    15 ILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVW 79

  Fly    66 DVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLP 130
            |||||:.||..||:|...|||:::|:||.|..|:|....||....:.....|..:|:|.||||||
  Fly    80 DVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLP 144

  Fly   131 GALSSNEIKEILHLEDI 147
            .|..:.|::::|.|.::
  Fly   145 NACGAMELEKLLGLNEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 53/147 (36%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 52/138 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.