DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and CG17819

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:160 Identity:50/160 - (31%)
Similarity:85/160 - (53%) Gaps:11/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILLLGLDNAGKTTILKR----FNGEPIDTISPT--LGFNIKTLEHNGYTLNMWDVGGQKSLRSYW 77
            :|:||||||||:|:..|    ||||..::.:..  ..|.|     |.:.:.:||:.|:...|..|
  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSFTI-----NNFRVQLWDINGELKNRQIW 82

  Fly    78 RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEIL 142
            ..|::..:.|::|:||.|.:||......|..:|..:.|..|.||::.||:|..|:||.:.:.:::
  Fly    83 PKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLM 147

  Fly   143 HLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            .|..:|...|.....|..||..:...::|:
  Fly   148 GLYRLTGRDWTFEECSMRTGSGVQEIVNWI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 50/160 (31%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 50/160 (31%)
Ras 23..183 CDD:278499 50/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.