DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and ARL1

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001168.1 Gene:ARL1 / 400 HGNCID:692 Length:181 Species:Homo sapiens


Alignment Length:179 Identity:77/179 - (43%)
Similarity:109/179 - (60%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMW 65
            ||.:.:.......||||||:||||.|||||||.|.. ||.:.|| ||:|||::|:.:......:|
Human     3 GFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTI-PTIGFNVETVTYKNLKFQVW 66

  Fly    66 DVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLP 130
            |:|||.|:|.|||.|:.:||.:::||||.||.|:.....||..:|:||.|..|.|:|..||||:.
Human    67 DLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDME 131

  Fly   131 GALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            .|::|:|:...|.|..:....|.:...||..|..|..:|:||:..:..|
Human   132 QAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 75/172 (44%)
ARL1NP_001168.1 Arl1 19..176 CDD:206718 71/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.