DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl1

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster


Alignment Length:166 Identity:79/166 - (47%)
Similarity:108/166 - (65%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWR 78
            ||||||:||||.|||||||.|.. ||.:.|| ||:|||::.:.:......:||:|||.|:|.|||
  Fly    15 REMRILILGLDGAGKTTILYRLQVGEVVTTI-PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWR 78

  Fly    79 NYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILH 143
            .|:.:||.:::|||||||.|:.....||..:|:||.||||.|:||.||||:.|.::..|:...|.
  Fly    79 CYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALG 143

  Fly   144 LEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            ||::....:.:...||..||.|..:||||...:..|
  Fly   144 LENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 78/160 (49%)
Arl1NP_524098.2 Arl1 18..175 CDD:206718 75/157 (48%)

Return to query results.
Submit another query.