DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl3l1

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_956987.1 Gene:arl3l1 / 393666 ZFINID:ZDB-GENE-040426-1649 Length:187 Species:Danio rerio


Alignment Length:179 Identity:82/179 - (45%)
Similarity:121/179 - (67%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFLTVLKKMR-QKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMW 65
            |..:|::|:: ..|:|:||:|||||||||||:||:...|.::||:||.|||||::..:|..||:|
Zfish     7 GLFSVIEKLKGTTEQELRIVLLGLDNAGKTTLLKQLASEDVNTITPTQGFNIKSVTCDGMKLNVW 71

  Fly    66 DVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLP 130
            |:|||:.:|.:|:.|.|:||.|::|:||||:.|.|..|.||..|:.||.|.|..||:..|||||.
Zfish    72 DIGGQRKIRPFWKKYLENTDLLIYVIDSADKKRFEETGLELSELIDEENLKGVPLLIFANKQDLA 136

  Fly   131 GALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            .|..::||.|.|:|.......|.:...|||:||.:...|:|:..:|..:
Zfish   137 TASPASEIAEGLNLHTYRDREWQIQACSAVSGEGVQDGMNWISNNIVNK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 80/172 (47%)
arl3l1NP_956987.1 Arl3 8..181 CDD:206721 80/172 (47%)
SAR 17..182 CDD:197556 78/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.