DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and ARF6

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001654.1 Gene:ARF6 / 382 HGNCID:659 Length:175 Species:Homo sapiens


Alignment Length:162 Identity:71/162 - (43%)
Similarity:104/162 - (64%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWR 78
            :|||||:||||.|||||||.:.. |:.:.|| ||:|||::|:.:.....|:||||||..:|..||
Human    12 KEMRILMLGLDAAGKTTILYKLKLGQSVTTI-PTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWR 75

  Fly    79 NYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILH 143
            :|:..|.||::|||.|||.|::...|||..::.:..:..|.:|:..||||||.|:..:||:|.|.
Human    76 HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG 140

  Fly   144 LEDITTHHWLVAGVSAVTGEKLLSSMDWLIAD 175
            |..|...:|.|....|.:|:.|...:.||.::
Human   141 LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 71/160 (44%)
ARF6NP_001654.1 ARF 1..175 CDD:128474 71/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.