DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and TRIM23

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001647.1 Gene:TRIM23 / 373 HGNCID:660 Length:574 Species:Homo sapiens


Alignment Length:171 Identity:69/171 - (40%)
Similarity:99/171 - (57%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRNY 80
            |:|::.||||.|||||||.:...:......||:|||::|:|:......:|||||:..||..|::|
Human   404 EIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHY 468

  Fly    81 FESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLE 145
            :.:|..:|:||||:.|.|:.....||..||.|:.|..|.||:..||||:.||||..||.|:|.|.
Human   469 YLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLH 533

  Fly   146 DITT-HHWLVAGVSAVTGEKLLSSMDWL--------IADIA 177
            .:.. ..|.:.|..|.:|..|...:|||        :.|:|
Human   534 KLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 67/167 (40%)
TRIM23NP_001647.1 mRING-HC-C3HC3D_TRIM23_C-IX 28..77 CDD:319559
Bbox2_TRIM23_C-IX_rpt1 123..172 CDD:380831
Bbox2_TRIM23_C-IX_rpt2 174..223 CDD:380832
BBC 226..370 CDD:128778
ARF-like 390..574 68/169 (40%)
ARD1 406..574 CDD:206723 67/167 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.