DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arf6a

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_956287.1 Gene:arf6a / 336063 ZFINID:ZDB-GENE-030131-8007 Length:175 Species:Danio rerio


Alignment Length:171 Identity:75/171 - (43%)
Similarity:107/171 - (62%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KMRQK---EREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGG 69
            ||..|   .:|||||:||||.|||||||.:.. |:.:.|| ||:|||::|:.:.....|:|||||
Zfish     3 KMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTI-PTVGFNVETVTYKNVKFNVWDVGG 66

  Fly    70 QKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALS 134
            |..:|..||:|:..|.||::|||.|||.|::...|||..::.:..:..|.:|:..||||||.|:.
Zfish    67 QDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK 131

  Fly   135 SNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIAD 175
            .:||:|.|.|..|...:|.|....|.||:.|...:.||.::
Zfish   132 PHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 75/169 (44%)
arf6aNP_956287.1 ARF 1..175 CDD:128474 75/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.