DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and CG11356

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_572786.2 Gene:CG11356 / 32178 FlyBaseID:FBgn0030375 Length:248 Species:Drosophila melanogaster


Alignment Length:189 Identity:43/189 - (22%)
Similarity:78/189 - (41%) Gaps:35/189 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILLLGLDNAGKTTILKRFN--GEPIDTISPTLG---FNIKTLEHNGYTLNMWDVGGQKSLRS 75
            |.::|:||...:|||.:..|.:  ....|....|.|   :.:|:.|.....|.:.:|||...::.
  Fly    30 EFQVLILGPSGSGKTELGHRLSRVSRDRDDQEATNGVRCYRMKSAEEPIAQLQLTEVGGNVEMQR 94

  Fly    76 YWRNYFESTDGLVWVVD-SADRMRLESCGQELQVLLQEERLAGATLLVLCNKQ-------DLPGA 132
            .|::|:.|:..|::..| .||.|.::.....|...|...:|||..:|::.::.       |:..|
  Fly    95 LWKHYYASSHALIYCFDLGADPMVMQGTFSLLTDCLVGTQLAGKPVLLVASRHRVGVQLYDVEYA 159

  Fly   133 LSSNEIKE-------ILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKRIFTLD 184
            ....|:.:       |.|:::.               |.|...:.||...:..|...||
  Fly   160 FGLEELAKSCDCPLLICHMDET---------------EDLHRGIRWLCHQLMARKSQLD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 40/178 (22%)
CG11356NP_572786.2 Gem1 27..>111 CDD:224025 21/80 (26%)
P-loop_NTPase 32..194 CDD:304359 39/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0073
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45697
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.