DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl10

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_006253691.2 Gene:Arl10 / 306767 RGDID:1303298 Length:243 Species:Rattus norvegicus


Alignment Length:159 Identity:58/159 - (36%)
Similarity:95/159 - (59%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKKMRQKEREMRILLLGLDNAGKTTILKRFNGE-PIDTISPTLGFNIKTLEHNGYTLNMWDVGGQ 70
            |:::.|:|    :|:||||.:||:|.|:...|: |::...||.|||...|....:.:::.::||.
  Rat    71 LEELEQRE----VLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKNFEVDLLEIGGS 131

  Fly    71 KSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSS 135
            ::||.||:.:....|.||::|||.||:||....||||.||.::  ....::::.|||||.||:|.
  Rat   132 QNLRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDKD--PDLPVVIVANKQDLSGAMSM 194

  Fly   136 NEIKEILHL--EDITTHHWLVAGVSAVTG 162
            .|:::.|.|  .|.....:|:|...|..|
  Rat   195 VELQQELGLLASDNQREVFLLAASIAPAG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 58/159 (36%)
Arl10XP_006253691.2 P-loop_NTPase 78..236 CDD:422963 56/152 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.