DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and alp41

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001342799.1 Gene:alp41 / 2541769 PomBaseID:SPAC22F3.05c Length:186 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:95/185 - (51%)
Similarity:133/185 - (71%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMW 65
            ||.||:|::.:.||||:|:|||||||||||||||....|.::.:|||.||.|:|||..|....:|
pombe     1 MGLLTILRQQKLKEREVRVLLLGLDNAGKTTILKCLLNEDVNEVSPTFGFQIRTLEVEGLRFTIW 65

  Fly    66 DVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLP 130
            |:||||:||::|:||||||:.::|||||.|.:|||.|...||.||.||:|...::|||.||.|:.
pombe    66 DIGGQKTLRNFWKNYFESTEAIIWVVDSLDDLRLEECRNTLQELLVEEKLLFTSILVLANKSDVS 130

  Fly   131 GALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAK-RIFTLD 184
            |||||.||.:||::....:.||.:..|||:||..:..::.||..|:.: ::.|:|
pombe   131 GALSSEEISKILNISKYKSSHWRIFSVSALTGLNIKDAISWLANDLKEIKLGTID 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 90/171 (53%)
alp41NP_001342799.1 Arl2 3..175 CDD:206720 90/171 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 195 1.000 Domainoid score I700
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1260
Inparanoid 1 1.050 200 1.000 Inparanoid score I1000
OMA 1 1.010 - - QHG53567
OrthoFinder 1 1.000 - - FOG0005745
OrthoInspector 1 1.000 - - oto100919
orthoMCL 1 0.900 - - OOG6_103223
Panther 1 1.100 - - LDO PTHR45697
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R81
SonicParanoid 1 1.000 - - X4140
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.