DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arf6

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_596822.1 Gene:arf6 / 2539937 PomBaseID:SPBC1539.08 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:75/159 - (47%)
Similarity:103/159 - (64%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWR 78
            :|||||:||||.|||||||.:.. .:.:.|| ||:|||::|:.:.....|:||||||..:|..||
pombe    20 KEMRILMLGLDAAGKTTILYKLKLNQSVVTI-PTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWR 83

  Fly    79 NYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILH 143
            :||..|.||::||||||..|:....|||..::.:..:....||||.||||||||||..:|.::|.
pombe    84 HYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQ 148

  Fly   144 LEDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            |:.:....|.|....|:||:.||..:.||
pombe   149 LDKLKDRLWNVQPTCALTGDGLLEGLAWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 75/159 (47%)
arf6NP_596822.1 Arf6 13..180 CDD:206716 75/159 (47%)
SAR 19..179 CDD:197556 75/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.