DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and warf-1

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_501242.1 Gene:warf-1 / 191609 WormBaseID:WBGene00000190 Length:179 Species:Caenorhabditis elegans


Alignment Length:158 Identity:71/158 - (44%)
Similarity:100/158 - (63%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRN 79
            |.|.|:||||.|||||||.:.. .|.::|| ||:|||::|:.....||.:|||||||.:|:.|:.
 Worm    17 ECRTLMLGLDGAGKTTILYKLKLNETVNTI-PTIGFNVETVTFQKITLTVWDVGGQKKIRALWKY 80

  Fly    80 YFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHL 144
            ||.:|..||:||||:|..|:....:||..||.|..||.:.|||..||||:|.|.|..|:.::|.|
 Worm    81 YFPNTTTLVFVVDSSDIERIPEAKEELFSLLAEPELADSHLLVFANKQDMPNARSPAELTQLLDL 145

  Fly   145 EDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            ..:....|.:.|.:|.:|:.|...:.|:
 Worm   146 GSLKNREWFICGTNAHSGQGLYEGLMWV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 71/158 (45%)
warf-1NP_501242.1 SAR 1..175 CDD:197556 71/158 (45%)
Arf_Arl 19..176 CDD:206644 70/156 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.