DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arf2

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_031503.1 Gene:Arf2 / 11841 MGIID:99595 Length:181 Species:Mus musculus


Alignment Length:160 Identity:74/160 - (46%)
Similarity:107/160 - (66%) Gaps:2/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYW 77
            ::|||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:...:..:||||||..:|..|
Mouse    15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLW 78

  Fly    78 RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEIL 142
            |:||::|.||::||||.||.|:....:||..:|.|:.|..|.|||..||||||.|:::.||.:.|
Mouse    79 RHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKL 143

  Fly   143 HLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            .|..:...:|.:....|.:|:.|...:|||
Mouse   144 GLHSLRQRNWYIQATCATSGDGLYEGLDWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 74/160 (46%)
Arf2NP_031503.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 74/160 (46%)

Return to query results.
Submit another query.