DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arf1

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_031502.1 Gene:Arf1 / 11840 MGIID:99431 Length:181 Species:Mus musculus


Alignment Length:175 Identity:79/175 - (45%)
Similarity:113/175 - (64%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG--FLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTL 62
            ||  |..:.|.:..| :|||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:...:.
Mouse     1 MGNIFANLFKGLFGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISF 63

  Fly    63 NMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQ 127
            .:||||||..:|..||:||::|.||::||||.||.|:....:||..:|.|:.|..|.|||..|||
Mouse    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQ 128

  Fly   128 DLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172
            |||.|:::.||.:.|.|..:...:|.:....|.:|:.|...:|||
Mouse   129 DLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 77/171 (45%)
Arf1NP_031502.1 Important for the stable binding to the membranes. /evidence=ECO:0000250|UniProtKB:P84080 3..16 3/13 (23%)
ARF 5..179 CDD:128474 77/171 (45%)

Return to query results.
Submit another query.