DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and si:ch1073-165f9.2

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_002663882.2 Gene:si:ch1073-165f9.2 / 100333040 ZFINID:ZDB-GENE-141216-228 Length:181 Species:Danio rerio


Alignment Length:168 Identity:73/168 - (43%)
Similarity:111/168 - (66%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSY 76
            ::::.|:|:.|||.|||||:|.:.. ||.:.|| ||:|||::|:|:...:..:||..||.:::|.
Zfish    14 EKKQTRLLMFGLDAAGKTTVLYKLKLGEVVTTI-PTIGFNVETVEYKNISFTVWDFSGQTTMKSL 77

  Fly    77 WRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEI 141
            ||:|:.:|.||::||||:||.|:|:..:||.:||.|:.|..|.||||.||||||.|:.:.|:.:.
Zfish    78 WRHYYSNTQGLIFVVDSSDRDRIETAAEELNLLLAEDELRDAVLLVLANKQDLPKAMLAQELTDR 142

  Fly   142 LHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            |.|..:|...|.|....||.|..|....|||...::|:
Zfish   143 LGLHALTGRQWFVQSTCAVQGSGLYEGFDWLTDQLSKQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 72/162 (44%)
si:ch1073-165f9.2XP_002663882.2 None

Return to query results.
Submit another query.