DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or19a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:382 Identity:86/382 - (22%)
Similarity:165/382 - (43%) Gaps:42/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WRL-------PPRTKPYWWLYY-----IWTLVVIVLVFIFIPYGLIMTGIKEFKNFTTTDLFTYV 85
            ||:       ||..:.:|..:|     :|.:...:.:::.....|:.          :..|.|:.
  Fly    16 WRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQ----------SNSLETFC 70

  Fly    86 Q---VPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHC 147
            :   |.:.....::|.|.|..||.:...:..::..:|.|....:|: |:..|.  ..|...|:..
  Fly    71 ESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDER-QIIMAG--IERAEFIFRT 132

  Fly   148 IYFGYLSMALTGALVIGKT--PFCLYNPLV----NPDDHFYLATAIESVT--MAGIILANLILDV 204
            |:.|.....:.|.:.|..:  |..:|...:    ......|||||:...|  ||.   |.|:|::
  Fly   133 IFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLHTTALMAN---ATLVLNL 194

  Fly   205 --YPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATM 267
              ||..|::::.:|.:.|:.|:..|.........:..|.||..:.||::|:....:|...:|.|.
  Fly   195 SSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTC 259

  Fly   268 FIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAIL-SQTFPFCYVCEQLSSDCESLTNTLFH 331
            |:|..|...........:.|.|..:.|.::.::.:.|| ::|...||..|....:.|||...::.
  Fly   260 FLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYS 324

  Fly   332 SKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNEM 388
            ..|:.....:|..:|..:...|..::..:|.|.||.:.|...|.|.|::::|::||:
  Fly   325 CNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 74/315 (23%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 74/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.