DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or94b

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:391 Identity:71/391 - (18%)
Similarity:155/391 - (39%) Gaps:49/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVV-IVLVFIFIPYGLIMTGIKEFKNFTTTDL-- 81
            :|:.:.|.|..:.|..........||..|:..|: :.|.|.:|       .:..::..|::|.  
  Fly    12 TLLVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLPLTFTYI-------ALMWYEAITSSDFEE 69

  Fly    82 ---FTYVQVPVNTNASIMKGIIVLFMRR----------RFSRAQKMMDAMDIRCTKMEEKVQVHR 133
               ..|:.:   |..:::..::.::.||          :...|..:.::.:|:..:..::     
  Fly    70 AGQVLYMSI---TELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQR----- 126

  Fly   134 AAALCNRVVVIYHCIYFGYLSMALTGALVI-----GKTPFCLYNPLV-NPDDHFYLATAIESVTM 192
                 |...:.|..|: |.|.:|:.|.:.:     .:.||..|.|.. ...:.::.|.....|.|
  Fly   127 -----NFKRIFYWYIW-GSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGYNVVAM 185

  Fly   193 AGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGN 257
            ....|:|::||.....::..:.....||..|::.|:...|   ::...||....:.|..:.....
  Fly   186 TLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAE---EKARPELRRIFQLHTKVRRLTR 247

  Fly   258 TLRPMISATMFIQLLSVGLLLGLAA---VSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLS 319
            ....::|..:..|::....::..:|   |.|.|.......|.:..:...::.|.|..||...:|:
  Fly   248 ECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELT 312

  Fly   320 SDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTI 384
            ....:|||::|.:.|:......|..:..::..:::.:...||..|.|.|...:|....|:|...:
  Fly   313 FHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFAL 377

  Fly   385 V 385
            :
  Fly   378 L 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 58/325 (18%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 57/322 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.