DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or94a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:360 Identity:66/360 - (18%)
Similarity:139/360 - (38%) Gaps:34/360 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WTLVVIV----LVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQV---PVNTNASIMKGIIVLFMRR 106
            ||....|    ...:.:|......|:...:.|.:::|....||   .:...|.::|.:.:...|.
  Fly    34 WTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRT 98

  Fly   107 RFSRAQ-KMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIG--KTPF 168
            ...|.. ::..|.|.:....||.....|..........||..|..|.:....||.|.:.  :.||
  Fly    99 EAWRLMYELQHAPDYQLHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPF 163

  Fly   169 CLYNPLV-NPDDHFYLATAIESVTMAGIILANLILDVYPIIYVVVLRIHMELLSERI---KTLRT 229
            ..|.|.. ..:..::.|...:...|....::|:.||.....::..:.:...||..|:   |.::.
  Fly   164 AYYVPFEWQNERRYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRLRETKNMKN 228

  Fly   230 DVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQF------- 287
            |...|.......::     |:.|.....|.:.::|..:..|::...|::..:...:|.       
  Fly   229 DTIFGQQLRAIFIM-----HQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNP 288

  Fly   288 --YNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIH 350
              :.::::.|     ::.||....| ||...:::.....|||.::|:.|:......|..:..::.
  Fly   289 GQFISMLQFV-----SVMILQIYLP-CYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYME 347

  Fly   351 NVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIV 385
            ::::.:...||..|.:.|...:|....|:|.:.::
  Fly   348 HLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 58/320 (18%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 58/317 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.