DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or88a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:340 Identity:64/340 - (18%)
Similarity:134/340 - (39%) Gaps:59/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PVNTNASIM--------KGIIVLFMRRRFSRAQKMMDAMDIRCTK---------MEEKVQVHRAA 135
            |.|.|..::        :| ::|:::|:  ...:.::.:|..|.:         |:|   .:|..
  Fly    76 PANQNPPVLSITIYFSIRG-LMLYLKRK--EIVEFVNDLDRECPRDLVSQLDMQMDE---TYRNF 134

  Fly   136 ALCNRVVVIYHCI---YFGYLSMALTGALVIGK-TPFCLYNPL--------VNPDDHFYLATAIE 188
            ....|.:.||..:   .|..:.:||......|| ||...:..|        |..|.:|||.....
  Fly   135 WQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSF 199

  Fly   189 SV--TMAGIILANLILDVYPII--YVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDH 249
            .:  |..|:.......:::.::  ::|   :|:..|:.:...:.......|::.:      ..|.
  Fly   200 DLMCTTCGVSFFVTFDNLFNVMQGHLV---MHLGHLARQFSAIDPRQSLTDEKRF------FVDL 255

  Fly   250 KLIVEYGNTLRPMISATMFIQLLSVGLLLG--LAAVSMQFY----NTVMERVVSGVY---TIAIL 305
            :|:|:....|..:  ...:..:..|..|:.  :.|.|:.||    :...:.::...|   |:.::
  Fly   256 RLLVQRQQLLNGL--CRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLV 318

  Fly   306 SQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNT 370
            ..||..|....||....|.|.::|...:|....||||...|.:....|::....|.|:..:.:..
  Fly   319 GFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVH 383

  Fly   371 NIKMAKFAFSVVTIV 385
            ..::.:.|:.:.|.:
  Fly   384 FTEIMQLAYRLFTFL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 62/332 (19%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 62/332 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.