DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or85d

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:262 Identity:45/262 - (17%)
Similarity:95/262 - (36%) Gaps:62/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 YHC-----------IYFGYLSMALTGALVIGKTPFCLYNPLVNPDDHFYLATAIESVTMAGIILA 198
            |:|           .||.|:|..:.|..       ||                      :|.:.|
  Fly   189 YYCWVPWDWSTGYSYYFMYISQNIGGQA-------CL----------------------SGQLAA 224

  Fly   199 NLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVEC-VKDHKLIVEYGNTLRPM 262
            ::::  ..::.:||:  |...||..|::....:  |..||..|.::. |..|:.::.....:..:
  Fly   225 DMLM--CALVTLVVM--HFIRLSAHIESHVAGI--GSFQHDLEFLQATVAYHQSLIHLCQDINEI 283

  Fly   263 ISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTN 327
            ...::....:|...::......|...:.:...|:..::....:.|.|......::|....|.:..
  Fly   284 FGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQ 348

  Fly   328 TLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFA-FSVVTIVNEMDLA 391
            .:::..|..|:.|||..::..|...||.              :.:|...|. .|:||:.:.:.|:
  Fly   349 AVYNHDWFRADLRYRKMLILIIKRAQQP--------------SRLKATMFLNISLVTVSDLLQLS 399

  Fly   392 EK 393
            .|
  Fly   400 YK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 40/246 (16%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 44/259 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.