DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or85b

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:287 Identity:52/287 - (18%)
Similarity:112/287 - (39%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEKVQVHRAAALCNRVVVIY------------------HCIYFGYLSMALTGALVIGK-TPFCLY 171
            ||:..:......|:|:.:||                  :.:|..:|::.     |:|| .|:.:|
  Fly   112 EERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIR-----VVGKQLPYLMY 171

  Fly   172 NPLVNPDDHFYLATAIESVTMAGIILA--NLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKG 234
            .|....|:..|. ..:.|...||...|  .:..||........|.:|.:.||..::......:..
  Fly   172 IPWKWQDNWSYY-PLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWK 235

  Fly   235 DDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSG- 298
            .|..:  ||:.|:.|:.|:...:.:..:....:.:..:....:  :..|..|....|...:|.. 
  Fly   236 KDSRF--LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFV--ICFVGFQMTVGVPPDIVVKL 296

  Fly   299 -VYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGG 362
             ::.::.:||.:..|:..:.::......:...::.||..|:.||:..::..|.. .|.:.|....
  Fly   297 FLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIAR-SQKVTFLKAT 360

  Fly   363 IF-PICLNTNIKMAKFAFSVVTIVNEM 388
            || .|..:|...:.:.::....::..|
  Fly   361 IFLDITRSTMTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 51/276 (18%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 51/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.