DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or63a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:395 Identity:74/395 - (18%)
Similarity:149/395 - (37%) Gaps:72/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FRSRDSLIYLNRSIDQMGWRL--PPRTKPYWWLYYIWTLVVIV--LVFIFIPYGLIMTGIKEFKN 75
            :||...:|.|:.::   |:.|  |.|...   :..|||:|:.|  |..::..:.::...|.:...
  Fly    15 YRSIREMIRLSYTV---GFNLLDPSRCGQ---VLRIWTIVLSVSSLASLYGHWQMLARYIHDIPR 73

  Fly    76 FTTTDLFTYVQVPVNTNASIMKGIIVLFMRR------RFSRA----------QKMMDAMDIRCTK 124
            ...|     ....:....||.|....||..|      |.:|.          ::|.|...|:..:
  Fly    74 IGET-----AGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIR 133

  Fly   125 MEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPDDHFYLATAIES 189
            .:.:..::|..|...|.::||.     |..:.:|....|......||.....|...:.:...:.|
  Fly   134 QQVESTMNRYWASTRRQILIYL-----YSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPS 193

  Fly   190 VTMA----GIILANLILDVY---PIIYV------------VVLRIH----MELLSERIKTLRTDV 231
            :..|    |:......:.:|   ..:|:            :||.:|    |..|::.::...:::
  Fly   194 LYPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSEL 258

  Fly   232 EKGDDQHYAELVECVKDHKLI----VEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVM 292
            .. .|:....|..|:..::.:    .|..|..|.:......:.|.:.||.|...:|.:. .|:.:
  Fly   259 VP-PDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLG-NNSSI 321

  Fly   293 ERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSIL 357
            ..:...:|.:|...|...:||..::.::..|.:.|..:..:|.|..|.:|       |.::..::
  Fly   322 TMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFR-------HLIRMMLM 379

  Fly   358 FTAGG 362
            .|..|
  Fly   380 RTNRG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 59/329 (18%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 59/328 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.