DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or56a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:396 Identity:66/396 - (16%)
Similarity:144/396 - (36%) Gaps:84/396 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IWTLVVIVLVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRRRFSRAQ 112
            ||....::|..:|..|..:..|.   .::.|...:..|.:.: .||.:.:..::..:|...|..|
  Fly    54 IWLSCALMLARVFRGYENLNDGA---TSYATAVQYFAVSIAM-FNAYVQRDKVISLLRVAHSDIQ 114

  Fly   113 KMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNP 177
            .:|...|.|  :||..|    |.....|.:.:     ..::...:.|.:....   |:|..|..|
  Fly   115 NLMHEADNR--EMELLV----ATQAYTRTITL-----LIWIPSVIAGLMAYSD---CIYRSLFLP 165

  Fly   178 DDHFYLATAIESVTMAGIILANLI-----------------------LDVYPIIYVVV------L 213
            ...|.: .|:.......|:|..|.                       :...|:.:..:      :
  Fly   166 KSVFNV-PAVRRGEEHPILLFQLFPFGELCDNFVVGYLGPWYALGLGITAIPLWHTFITCLMKYV 229

  Fly   214 RIHMELLSERIKTLRTDVEKGDDQ------HYAELV--------ECVKDHKLIVEYGNTLRPMIS 264
            .:.:::|::|::.:  |:.:.:.:      ..:||.        |.||:...|.::...|:.:|.
  Fly   230 NLKLQILNKRVEEM--DITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLIC 292

  Fly   265 A---------TMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSS 320
            .         ::.|..|...|.:|:.:....|:..:...|::|:..|.....|         |..
  Fly   293 VPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHAT---------LIV 348

  Fly   321 DC-ESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTI 384
            :| :.|:...|...|...|...:..:::.:.:.|:.:...| .:..:.|.|.|.:.:.|:|...:
  Fly   349 ECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNL 412

  Fly   385 VNEMDL 390
            :....|
  Fly   413 LRSSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 57/354 (16%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 46/305 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.