DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or49a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:388 Identity:81/388 - (20%)
Similarity:153/388 - (39%) Gaps:50/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSRDSLIYL-NRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGLIMTGIKEFKNFTTT 79
            ||.:..|:: |.....:|:.|....||:|....:....|:..:..|....::.|.|.|:::...:
  Fly     5 RSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGS 69

  Fly    80 DL--------FTYVQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQVHRAAA 136
            ..        |.|:.      :|.:|.|..:..|:|..:....:..:.....:.:.|.:|::...
  Fly    70 PSKIMRQGLHFFYML------SSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYL 128

  Fly   137 LCNRVVVIYHCIYFGYLSMALTGALV---------IGKTPFC---LYNPLVNPDDH----FYLAT 185
            .|:...|:| ..||..:.|||. .||         .||..|.   ::...:..|..    :.||.
  Fly   129 SCSTRNVLY-VYYFVMVVMALE-PLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAY 191

  Fly   186 AIESVTMAGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHK 250
            .|:......|:..:|..|::.:.....:.:|:..|:..:.::|...|. :.|....|...:|.|:
  Fly   192 VIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPET-EQQDCDFLASIIKRHQ 255

  Fly   251 LIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVME----RVVSGVYTIAILSQTFPF 311
            |::.....:..:....:...|.:...||...|     |.||:|    ..:|.:...|.::..|  
  Fly   256 LMIRLQKDVNYVFGLLLASNLFTTSCLLCCMA-----YYTVVEGFNWEGISYMMLFASVAAQF-- 313

  Fly   312 CYVCE---QLSSDCE-SLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNT 370
             ||..   |:..|.. :|....|.|||.....||:..:|..:...|:.:..:|.|:..|.|:|
  Fly   314 -YVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 67/326 (21%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.