DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or35a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:426 Identity:80/426 - (18%)
Similarity:165/426 - (38%) Gaps:113/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGLIMTGIKEF----KNFTT--TDLFTYVQ 86
            ::.:.|.|.|.|..  |..|:..::.:.:..:|:.:.........|    :|...  |.:.||: 
  Fly    25 LNHIFWPLDPSTGK--WGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYL- 86

  Fly    87 VPVNTNASIMKGIIVLFMRRRFSRAQKMMDA------MDIRCTKMEEKVQVHRAAALCNRVVVIY 145
              :...|......|:|    .|.:.||.::.      :|.|  |..|..:......:.||:|   
  Fly    87 --ILVEAQFRSLHILL----HFEKLQKFLEIFYANIYIDPR--KEPEMFRKVDGKMIINRLV--- 140

  Fly   146 HCIYFGYLSMALTGAL--VIGKTPFCLYNPLVNPDD----HFYLATAIESVTMAGIIL------- 197
            ..:|...:|:.|...:  :|.::...||: ::.|.|    :.::...:.:| ..||::       
  Fly   141 SAMYGAVISLYLIAPVFSIINQSKDFLYS-MIFPFDSDPLYIFVPLLLTNV-WVGIVIDTMMFGE 203

  Fly   198 ANLILDVYPIIYV----VVLRIHMELLSERIKTLRTDVEKGDDQHYAE-----LVECVKDHKLIV 253
            .||:.::  |:::    ::|:..::|..|:|...|      |..|.|:     :.:.::.:..:.
  Fly   204 TNLLCEL--IVHLNGSYMLLKRDLQLAIEKILVAR------DRPHMAKQLKVLITKTLRKNVALN 260

  Fly   254 EYGNTLRPMISATMFIQL-LSVGLLLGLAAVSMQFYNTVMERVVSGVY----TIAILSQTFPFCY 313
            ::|..|....:..:||.. .:.||   |.|:|.:.|...|...:..::    |:.:||       
  Fly   261 QFGQQLEAQYTVRVFIMFAFAAGL---LCALSFKAYTNPMANYIYAIWFGAKTVELLS------- 315

  Fly   314 VCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIH---------NVQQSIL------------ 357
             ..|:.||....|::|             :||.|..|         |..:::.            
  Fly   316 -LGQIGSDLAFTTDSL-------------STMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMN 366

  Fly   358 ---FTAGGI--FPICLNTNIKMAKFAFSVVTIVNEM 388
               |...|:  |.:.|...:|:.:.:||..|.:..|
  Fly   367 SKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 67/362 (19%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 68/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.