DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or33c

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:369 Identity:82/369 - (22%)
Similarity:154/369 - (41%) Gaps:55/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IWTLVVIVLVFIFIPYGLIM------TGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRR 106
            ::.:::.:||.::.|..|::      :..:.|||.|.:  .|.|       |..:|.:..|:...
  Fly    34 LYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMS--LTCV-------ACSLKHVAHLYHLP 89

  Fly   107 RFSRAQKMMDAMDIRCTKMEE----KVQVHRAAALCNRVV-----VIYHCIYFGYLSMALTGALV 162
            :....:.:::.:|......:|    :..||..|....|.:     :||....||.....::|.  
  Fly    90 QIVEIESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGN-- 152

  Fly   163 IGKTPFCLYNPLVNPDDHFYLATAIESVTMAGII-----LANLILDVYPIIYVVVLRIHMELLSE 222
             .:..:..|.|.....:.|..|.|:.....:.::     |.|   |.|..:.:.:|..|:.|.|.
  Fly   153 -WELLYPAYFPFDLESNRFLGAVALGYQVFSMLVEGFQGLGN---DTYTPLTLCLLAGHVHLWSI 213

  Fly   223 RIKTLRTDVEKG--DDQ---HYAELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAA 282
            |:..|      |  ||:   ::..|::.::.|||:|.:.|.:...||....:||...|..|.:..
  Fly   214 RMGQL------GYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIV 272

  Fly   283 VSMQFYNTVMERVVSGVYTI----AILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRT 343
            ..|.|:   :...:|.||.:    .:..|.||.||...:::.:.|.|...:|.|:|....|.:|.
  Fly   273 SYMLFF---VGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRF 334

  Fly   344 TMLYFIHNV--QQSILFTAGGIFPICLNTNIKMAKFAFSVVTIV 385
            .:|.|....  .:..:..|||:..:.||......|.|:|:..:|
  Fly   335 DLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 72/326 (22%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 75/335 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.