DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or23a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:373 Identity:76/373 - (20%)
Similarity:158/373 - (42%) Gaps:58/373 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YYIWTLVVIVLVFIFIPYGLIMTGIKEFK-----NFTTTDLFTYVQVPVNTNASIMKGIIVLFMR 105
            |:.|::::.:||  ::|..:::.|:..|:     ||:       :.:.|.:.:::||..:.:...
  Fly    32 YWSWSMLLCILV--YLPTPMLLRGVYSFEDPVENNFS-------LSLTVTSLSNLMKFCMYVAQL 87

  Fly   106 RRFSRAQKMMDAMDIRCTKMEEKVQVHRAAA----LCNRVVVIYHCIYFGYLSMALTGALVIGKT 166
            .:....|.::..:|.|.:. |.:.:.||...    ..:::..|.:.:.|           :|...
  Fly    88 TKMVEVQSLIGQLDARVSG-ESQSERHRNMTEHLLRMSKLFQITYAVVF-----------IIAAV 140

  Fly   167 PF------CLYNPLVNPDD------HFYLATAIESVTMAGIILANLILDVYPIIYVVVLRIHMEL 219
            ||      .|..|:..|.|      .:..|...:.:.....|:.....|.:|.:.:.::....:|
  Fly   141 PFVFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYVFQIMQCFAADSFPPLVLYLISEQCQL 205

  Fly   220 LSERI-------KTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLL 277
            |..||       |||        :::..:||.|::|...:....:..:.::|..|.:|.:.:|:.
  Fly   206 LILRISEIGYGYKTL--------EENEQDLVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGIN 262

  Fly   278 LGLAAVSMQFY-NTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRY 341
            :.:....:.|| .|:.:|:....:.:.|..||:|.||....:......|...:|.|.|:.....|
  Fly   263 IAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASY 327

  Fly   342 RTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNEMD 389
            |..||......::..|..||.:.||.|:|.:...|.|:|..|::.:.|
  Fly   328 RGHMLILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYSFFTLMADRD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 63/325 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 65/332 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.