DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or22c

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:367 Identity:65/367 - (17%)
Similarity:129/367 - (35%) Gaps:78/367 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQV-----PVNTNASIMKGIIVLF-MRRRFSRAQKM 114
            |:|:| .:.:::.|.....::....|...|..     |..|.|..:..:.|.| ..||::...:.
  Fly    43 LLFVF-AFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQR 106

  Fly   115 MDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPDD 179
            :.|:.....:.|.:..:...|...||            ||:.|..:.......|.| .||:....
  Fly   107 LRAILWESRRQEAQRMLVGLATTANR------------LSLLLLSSGTATNAAFTL-QPLIMGLY 158

  Fly   180 HFYLATAIESVTMAGIILANLILD--VYPIIYVV------------------------------- 211
            .:.:....::.....|||.:..:.  |:|:.||:                               
  Fly   159 RWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFR 223

  Fly   212 -----VLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQL 271
                 :.||..:|..:.:... |:....:.:|  .|.:.|:.|..|:::...|....:..:.:..
  Fly   224 LVQQDIRRIFADLHGDSVDVF-TEEMNAEVRH--RLAQVVERHNAIIDFCTDLTRQFTVIVLMHF 285

  Fly   272 LSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIG 336
            ||...:|....:.:....:.:..:....|.||.|:|.|.:|:....:|....::.:.|:..:|..
  Fly   286 LSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYK 350

  Fly   337 AERRYRTTMLYFIHNVQ-----------------QSILFTAG 361
            .:.|.|..:|..:...|                 :|||.|||
  Fly   351 CDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 61/346 (18%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/338 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.