DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or9a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:404 Identity:74/404 - (18%)
Similarity:136/404 - (33%) Gaps:100/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IQEPVLGSLFRSRDS------LIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIF-IPY 63
            :.:.|.|.....:|.      |:|....||.  |. |.......||    |.|.:..:|:| :|.
  Fly     1 MSDKVKGKKQEEKDQSLRVQILVYRCMGIDL--WS-PTMANDRPWL----TFVTMGPLFLFMVPM 58

  Fly    64 GLIMTGIKEFKNFTTTDLFTYVQVPVNTNAS-------IMKGIIVLFMRRRF------------S 109
            .|           ...:..|.|.:..:|..|       ::|.::..:.|:.|            .
  Fly    59 FL-----------AAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAK 112

  Fly   110 RAQKMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCI--YFGYLSMALTGALVIGKTPFCLYN 172
            ..:...||.:|...:.:....:......|..:..|:..:  :.|.:..::.|..:..:.|   :|
  Fly   113 EIEVWPDAREIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELP---HN 174

  Fly   173 PLVNPDD----HFYLAT-------AIESVTMAGIILANLILDVYPIIYVVVLRIHMELLSERIKT 226
            . |.|.|    .||:.|       :..:||||..:.:.|....|.:..:..:..|..:....:  
  Fly   175 G-VYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAV-- 236

  Fly   227 LRTDVEKGDDQHYAELVECVKDHKLIVEYGNTL----RPMISATMFIQLLSVGLLLGLAAVSMQF 287
                   |..:....||:.:..|:..::..:.:    ||:|....|:..|.: ..:|.....: |
  Fly   237 -------GGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQI-CFIGFQVADL-F 292

  Fly   288 YNTVMERVVSGVYTIA----ILSQTFPFCYVCEQLSSDCESLTNTLFHSKW------------IG 336
            .|.      ..:|.||    :|...|.:....|.:.|......|.|:.:.|            |.
  Fly   293 PNP------QSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIA 351

  Fly   337 AERRYRTTML--YF 348
            |.|..|...:  ||
  Fly   352 AMRAQRPCQMKGYF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 57/326 (17%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 56/319 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.