DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or65a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:415 Identity:81/415 - (19%)
Similarity:161/415 - (38%) Gaps:90/415 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SRDSLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGLIMTGIKEFKN------ 75
            :||.|..|...::....|||   :...|.|::...:...|..:|  || |...|.:..|      
  Fly    42 TRDQLKALGFYMNSEQRRLP---RIVAWQYFVSIQLATALASLF--YG-ISESIGDIVNLGRDLV 100

  Fly    76 FTTTDLFTYVQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMD------IRCTKMEEKVQVHRA 134
            |..|.:|...:              ::|..:.......::||::      |:....:|..:..|.
  Fly   101 FIITIIFICFR--------------LVFFAQYAGELDVIIDALEDIYHWSIKGPATKEVQETKRL 151

  Fly   135 AALCNRVVVIYHCIYFGYLSMAL-----TGALVIGKT-------PFCLYNPLVNPDDHFYLATAI 187
            ..|....::|   .:|.:|.:.:     |...:..:|       ||.|::|..:|..:..:..: 
  Fly   152 HFLLFMALII---TWFSFLILFMLIKISTPFWIESQTLPFHVSWPFQLHDPSKHPIAYIIIFVS- 212

  Fly   188 ESVTMAGIILANLILDVYPIIYV-VVLRIHMELLSERIKTLRT---------DVEKGD-DQHYAE 241
            :|.||           :|.:|:: ||..:.:.|..|....||.         ::..|| |..|.|
  Fly   213 QSTTM-----------LYFLIWLGVVENMGVSLFFELTSALRVLCIELRNLQELCLGDEDMLYRE 266

  Fly   242 LVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTV---------MERVVS 297
            |....|.|:.|:...:....:.:....:|:| :..||    ||:..:..:         :|.::.
  Fly   267 LCRMTKFHQQIILLTDRCNHIFNGAFIMQML-INFLL----VSLSLFEVLAAKKNPQVAVEYMII 326

  Fly   298 GVYTIAILSQTFPFCYVCEQLSSDCESLTNTLF--HSKWIGAERRYRTTMLYFIHNVQQSILFTA 360
            .:.|:..||....|   .:..|.:.|.:...::  :...:|::..:| ...:||...|:.::..|
  Fly   327 MLMTLGHLSFWSKF---GDMFSKESEQVALAVYEAYDPNVGSKSIHR-QFCFFIQRAQKPLIMKA 387

  Fly   361 GGIFPICLNTNIKMAKFAFSVVTIV 385
            ....|..|...:.:.|..:|::||:
  Fly   388 SPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 61/341 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 54/284 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.