DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85a and Or69a

DIOPT Version :9

Sequence 1:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:379 Identity:69/379 - (18%)
Similarity:141/379 - (37%) Gaps:65/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IWTLVVIVLVFIFIPYGLIMTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIV--------LFM 104
            |:.|..:.||:..|  |.:|.|.  |.:..|.|...|: ..:.:.||::...||        |.:
  Fly    41 IFWLGAVNLVYHNI--GCVMYGY--FGDGRTKDPIAYL-AELASVASMLGFTIVGTLNLWKMLSL 100

  Fly   105 RRRFSRAQKMMDAMDIRCTKMEEKVQV--HRAAALCN---------RVVVIYH---CIYFGYLSM 155
            :..|...          ..:.||..|:  |||..:.:         |...|:|   .:|:..|.:
  Fly   101 KTHFENL----------LNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPI 155

  Fly   156 AL-----------TGALVIGKT--PFCLYNPLVNPDDHFYLATAIESVTMAGIILANLILDVYPI 207
            .|           .|..:...|  |:.:...:..    |:.|.|.:..:....:..|:.:.....
  Fly   156 LLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPG----FFAAVACQIFSCQTNMCVNMFIQFLIN 216

  Fly   208 IYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQLL 272
            .:.:.|.||.:.|:.:::|:........||    |...:..|..::...:.:....:.|..|. |
  Fly   217 FFGIQLEIHFDGLARQLETIDARNPHAKDQ----LKYLIVYHTKLLNLADRVNRSFNFTFLIS-L 276

  Fly   273 SVGLLLG-LAAVSMQFYN--TVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKW 334
            ||.::.. ..|.||..::  |.::.::.   .:..::..|..|.....|......:....|::.|
  Fly   277 SVSMISNCFLAFSMTMFDFGTSLKHLLG---LLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNW 338

  Fly   335 IGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNEM 388
            ...:..||..:|..:....:..::....:.|:.:.|.:...||::.:.|.|..:
  Fly   339 YEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 58/339 (17%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 55/331 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.