DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and Pax7

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_006239325.1 Gene:Pax7 / 500574 RGDID:1564360 Length:505 Species:Rattus norvegicus


Alignment Length:382 Identity:141/382 - (36%)
Similarity:178/382 - (46%) Gaps:78/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGA 75
            |.||||||||:|||||||..|.:|||:|..|||||.||||||||||||||||.||.|||||.|||
  Rat    36 GRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA 100

  Fly    76 IGGSKPR-VTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPS--VSSISRILRNKLG 137
            ||||||| |.||.|...|.|.|:.:||:|:||||||||.:|.||::.|||  ||||||:||.|.|
  Rat   101 IGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKFG 165

  Fly   138 SL------------GHQHTPGTVMGSGSSSG-----GGSVSSNGG------QNNGTSASNNINLS 179
            ..            |.:....::.|.....|     |..|.|...      |....:......|.
  Rat   166 KKEDDEEGDKKEEDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLE 230

  Fly   180 NLGNPGGGPHHPHHHHHHQSAAAAASAHHVHAHAHAHAHLYN--SIYQPYSAA---AAYSMKTPC 239
            .|.......|:|..:...:.|.....     ..|.......|  :.::..:.|   ||::...|.
  Rat   231 ELEKAFERTHYPDIYTREELAQRTKL-----TEARVQVWFSNRRARWRKQAGANQLAAFNHLLPG 290

  Fly   240 GSPSPPQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMG 304
            |.|..     |..::| |:||...|       :|:: :||               |.|       
  Rat   291 GFPPT-----GMPTLP-PYQLPDSA-------YPTT-TVS---------------QDG------- 319

  Fly   305 GMGSTV-SPLPMTPSPV--AGTAGGQPLLDCEGGAGQQSPYNYYM-YFQNGGMHHHH 357
              |||| .|.|:.||.:  .|.|......|.....|.:..::.|. .|.|.|...:|
  Rat   320 --GSTVHRPQPLPPSTMHQGGLAAAAAAADSSSAYGARHSFSSYSDSFMNPGAPSNH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 89/124 (72%)
Pax7XP_006239325.1 PAX 34..161 CDD:128645 89/124 (72%)
Homeobox 220..274 CDD:395001 7/58 (12%)
Pax7 <354..385 CDD:403540 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.