DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and toy

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster


Alignment Length:283 Identity:115/283 - (40%)
Similarity:144/283 - (50%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CPQYGE--VNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETG 69
            |...|.  :||||||:|||||||::||.:|||||..|.|||||||.|:||:|||||||.||:|||
  Fly    25 CSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETG 89

  Fly    70 SILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRN 134
            ||.|.|||||||||.|..||..|.:.|:..|.|||||||||||||.:|:..|:||||||:|:|||
  Fly    90 SIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRN 154

  Fly   135 KLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQS 199
             |.|...|.                     .|....|....:.:.| |..||...:|.:      
  Fly   155 -LASQKEQQ---------------------AQQQNESVYEKLRMFN-GQTGGWAWYPSN------ 190

  Fly   200 AAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVA 264
               ..:||                   .:...|.|:.|   ||:...|...:..|    |.|.:.
  Fly   191 ---TTTAH-------------------LTLPPAASVVT---SPANLSGQADRDDV----QKRELQ 226

  Fly   265 AAAAAAHWPSSHSVSDILAHHQA 287
            .:...:|..|..|.||..:.|.:
  Fly   227 FSVEVSHTNSHDSTSDGNSEHNS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 84/124 (68%)
toyNP_001368990.1 PAX 29..153 CDD:128645 84/123 (68%)
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.