DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and Ptx1

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:201 Identity:52/201 - (25%)
Similarity:77/201 - (38%) Gaps:40/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDPESQCPQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARY 65
            |.|.|........:.:|.|   |.|.|..|... ..:.|....|| :|..:..|...: ::.|:.
  Fly   413 MLPGSMGSSLSNTSNVGAV---GAPCPYTTPAN-PYMYRSAAEPC-MSSSMSSSIATL-RLKAKQ 471

  Fly    66 HETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISR 130
            |        |..|.....:.|..|:     :....|:.|            |..|.| .|:.:  
  Fly   472 H--------ASAGFGSPYSAPSPVS-----RSNSAGLSA------------CQYTGV-GVTDV-- 508

  Fly   131 ILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINL----SNLGNPGGGP-HH 190
            :..|.||:|.:||.......||.|.||..| .||.|.:..:..::.||    |:||..|||| :|
  Fly   509 VXENALGALLNQHQHHLQHFSGGSVGGSGV-PNGMQQHSGNMLHHSNLGLDHSDLGLVGGGPSNH 572

  Fly   191 PHHHHH 196
            ....:|
  Fly   573 QDEGNH 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 23/122 (19%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.