DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and Pph13

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:340 Identity:67/340 - (19%)
Similarity:93/340 - (27%) Gaps:156/340 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RNKLGSLGHQHTPG-----------TVMGSGSSS--GGGSV-------SSNGGQNN-----GTSA 172
            :.|:|.||..:..|           .|:|...|:  |||::       |||...|.     ||.|
  Fly    68 QEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGA 132

  Fly   173 SN----------NINLSNLGNPGGG----------------------------PHHPHHHHHHQS 199
            .:          |:|:.:||...||                            ..||...|....
  Fly   133 MSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHASDP 197

  Fly   200 AAAAASAHHVHAHAHAHAHLYNSIYQP---YSA---------AAAY----------------SMK 236
            ..|.:|:||...........:|....|   ::|         ::||                |.|
  Fly   198 IHAGSSSHHQQQQQQHQQEQHNPQLHPGLEFAASLSLDMTDGSSAYDEMKFLSVDVDQFTIDSFK 262

  Fly   237 TPC---GSPSPPQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAV-ALRASCQVG 297
            ..|   ...|..|..||                                 |.|.| :....|..|
  Fly   263 ADCILSMEQSQMQAYGG---------------------------------HSQLVGSSNELCLDG 294

  Fly   298 VGVGGMG-GMGSTVSPLPM------TPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGMHH 355
            :|:...| ..|...||..:      .||...|..|...|::                    .:||
  Fly   295 IGMSSFGMEEGEPKSPPSLLVLDKSLPSLSIGVEGIADLVE--------------------QLHH 339

  Fly   356 HHHHGGMMAAGA-TG 369
            |.|.||.:..|. ||
  Fly   340 HQHEGGPVGGGVITG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 67/340 (20%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.