DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and al

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:302 Identity:64/302 - (21%)
Similarity:85/302 - (28%) Gaps:96/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SVSSISRILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASN-------------- 174
            :|..:.|...:...|.|...|....:..|:.||....|  ||.|:..|..|              
  Fly    23 AVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGAS--GGTNSPVSDGNSDCEADEYAPKRKQ 85

  Fly   175 --------NINLSNLGNPGGGPHHPHHHHHHQSA------------------AAAASAHHVHAHA 213
                    :..|..|.......|:|......:.|                  |.......|...:
  Fly    86 RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQS 150

  Fly   214 HAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPH---QLRSVAAAAAAAHWPSS 275
            |.        |.||....|.:|:|..|:..||.        |..|   |||....|..||:    
  Fly   151 HP--------YNPYLPGGAATMQTVVGAALPPN--------PFTHLGFQLRKPFDAQHAAN---- 195

  Fly   276 HSVSDILAHHQAVALRASCQVGVGV-------------GGMGGMGSTVSPLP-----MTPSPVAG 322
                  ||..:...|.|:..:..|.             .||.||.|..|...     ||..| .|
  Fly   196 ------LAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVP-RG 253

  Fly   323 TAGGQPLLDCEGGAGQQSPYNYYMYF-----QNGGMHHHHHH 359
            |..|:|.....|.....|| |:.:..     .:|....|..|
  Fly   254 TPLGKPPALLVGSPDLHSP-NHMLASPPTSPASGHASQHQQH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 2/8 (25%)
alNP_722629.1 Homeobox 89..141 CDD:278475 6/51 (12%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.