DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and unc-4

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:224 Identity:54/224 - (24%)
Similarity:73/224 - (32%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAA 231
            ||.:|||.|.|..|..|....|..........|:.::.|..:.| ..:|..||...  .|.||.:
  Fly    17 NNNSSASRNNNSHNNNNNNHSPKEIPEETGRSSSTSSNSIPNAH-RTNAGQHLLGG--SPSSACS 78

  Fly   232 AYSMKTPCGSPS-------------------------PPQGAGGQGSVP---------------- 255
              :..:.||.||                         ||.|...|..||                
  Fly    79 --TSVSGCGMPSEGLHPTAALQLYAAAAQLAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFD 141

  Fly   256 ------HPHQLRSVAAAAAAAHWPSSHSVSDILAH---HQAVALR-ASCQVGVGVGGMGGMGSTV 310
                  ||:.    |||||||...::.:.|:..|:   ..|.||| .|......|..:....:|:
  Fly   142 AASAGGHPNS----AAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATI 202

  Fly   311 ---------SPLPMTPSPVAGT--AGGQP 328
                     ..||....|..|:  .||.|
  Fly   203 QHRLMIGNRQSLPPAGPPSEGSNEDGGFP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475
NK <327..>368 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.