DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and CG11294

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:129 Identity:36/129 - (27%)
Similarity:48/129 - (37%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SLGHQHTPGTVMGSGSSSGGGSVSSNGG--------QNNGTSASNNINLSNLGN-PGGGPH---H 190
            |||   || .|||.|:..||   |.||.        ..|.:|||.:..|:.:|| |..|..   |
  Fly    98 SLG---TP-PVMGGGAVQGG---SGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGSFTMMH 155

  Fly   191 PHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSV 254
            |.....||      ...|   ..|..|...:.:.:.|:....|.      :||.....||..::
  Fly   156 PAFQQQHQ------QQQH---QGHQQATDQDKLSKTYTELKLYK------APSHGMELGGMAAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.