DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and Pax2

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_006231505.2 Gene:Pax2 / 293992 RGDID:1305568 Length:432 Species:Rattus norvegicus


Alignment Length:415 Identity:150/415 - (36%)
Similarity:189/415 - (45%) Gaps:102/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DPESQC-PQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARY 65
            ||.|.. |.:|.|||||||||||||||:..|.||||||..|:||||||||||||||||||||.||
  Rat     8 DPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRY 72

  Fly    66 HETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISR 130
            :|||||.||.||||||:|.|||||:.|.|.|:::|.:||||||||||:|||||...|||||||:|
  Rat    73 YETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINR 137

  Fly   131 ILRNK---------------LGSLGHQHTPGTV---MGSGSSSGGGSVSSNG----GQNNGTSAS 173
            |:|.|               :.:.||...|.|.   :.|.|:...||.|.||    .::||....
  Rat   138 IIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRK 202

  Fly   174 NNINLSNLGNP----GGGPHH-------------PHHHHHHQSAAAAASAHHVHAHAHAHAHL-- 219
            .. .:....:|    |||..|             |   :....:...:...|:.|.......|  
  Rat   203 RE-EVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVP---NGDSQSGVDSLRKHLRADTFTQQQLEA 263

  Fly   220 ---------YNSIYQ-----------PYSAAAAYSMKTP---------CGSPSPPQGAGGQGS-- 253
                     |..::|           .||..|.    ||         ..|.:|..|:...|:  
  Rat   264 LDRVFERPSYPDVFQASEHIKSEQGNEYSLPAL----TPGLDEVKSSLSASTNPELGSNVSGTQT 324

  Fly   254 -----------------VPH--PHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVG 299
                             .||  |....|...:..|...|.|....:..:|.|..|...:.:....
  Rat   325 YPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNP 389

  Fly   300 VGGMGGMGSTVSPLPMTPSPVAGTA 324
            ...|...|:  .|||:.|.|:..|:
  Rat   390 ALLMPPPGA--PPLPLLPLPMTATS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 93/122 (76%)
Pax2XP_006231505.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.