DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and pax9

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002935394.1 Gene:pax9 / 100485934 XenbaseID:XB-GENE-482238 Length:360 Species:Xenopus tropicalis


Alignment Length:395 Identity:162/395 - (41%)
Similarity:190/395 - (48%) Gaps:133/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSIL 72
            |.:|||||||||||||||||||.|:||||||:||||||||||||||||||||||||||:||||||
 Frog     3 PAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSIL 67

  Fly    73 PGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLG 137
            ||||||||||||||.||.:||..|||||||||||||||||::|:|||.|||||||||||||||:|
 Frog    68 PGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIG 132

  Fly   138 SLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAA 202
            :|..|                                              :|...|..|.:||:
 Frog   133 NLAQQ----------------------------------------------NHYESHKQHPAAAS 151

  Fly   203 AASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVAAAA 267
            |...:|::::             |...||...:.||.|.||.|      |::..|..        
 Frog   152 ALPYNHLYSY-------------PSPIAAGAKVPTPPGMPSIP------GTMGMPRT-------- 189

  Fly   268 AAAHWPSSHSVSDIL---------------------------------AHH-----QAVALRASC 294
                |||||||:|||                                 |.|     :..:|....
 Frog   190 ----WPSSHSVTDILGIRSITDQVSDTSPYPSPKLEEWSSLSRNTFQSAQHVLNGLEKSSLEQEV 250

  Fly   295 QVGVGVGGMGGMGSTVSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGM---HHH 356
            :......|:..:...|:...|||.|.....               |||..|......|.   |..
 Frog   251 KYSQSASGLPAVSGFVAASGMTPYPTTAPV---------------SPYMAYSTAAPTGYVTGHGW 300

  Fly   357 HHHGG 361
            .|.||
 Frog   301 QHTGG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 108/122 (89%)
pax9XP_002935394.1 PAX 6..131 CDD:238076 111/124 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2478
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3001
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1339212at2759
OrthoFinder 1 1.000 - - FOG0003351
OrthoInspector 1 1.000 - - otm47951
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2237
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.