DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and LOC100485335

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:146 Identity:32/146 - (21%)
Similarity:54/146 - (36%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 HQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVP------ 255
            :|...|:.::.|:..::...:.:|.||.||.::.:....       |........||:|      
 Frog   139 NQRRQASNTSSHLSINSSFSSSVYQSIPQPSNSGSMLGR-------SEAAITNSYGSLPPLPSFT 196

  Fly   256 HPHQLRSVAAAAAAAHW----PSSHSVS----DILAHHQAVALRASCQVGVGVGGMGGMGSTVSP 312
            .|:.|.....|:..:.:    .||.|||    |.....|.....::..:|.|.....|:   :||
 Frog   197 MPNNLPIQPIASQTSTYSCMISSSPSVSVRSYDAYTPPQLQTHMSNQNLGSGASSSTGL---ISP 258

  Fly   313 LPMTPSPVAGTAGGQP 328
            ....|..|   .||.|
 Frog   259 GVSVPVQV---PGGDP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.