DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and CTR1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_015449.1 Gene:CTR1 / 856241 SGDID:S000006328 Length:406 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:44/196 - (22%)
Similarity:73/196 - (37%) Gaps:52/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLV----SFLYEALKFLRQQLARR 69
            |.|.|:.|::  ||..|...   .|           .|..|||:    :|:|:.|.|:...|...
Yeast   132 TPTYKNYPVL--FHHLHANN---SG-----------KAFGIFLLFVVAAFVYKLLLFVSWCLEVH 180

  Fly    70 EARRASEQLAAEQRRKNEAPAAGGCCSEAPLAE----------PREQTYWQRLFASS------HI 118
            ..::..     :|.:.:..|:|.. ..|....:          |:.......:|..|      .|
Yeast   181 WFKKWD-----KQNKYSTLPSANS-KDEGKHYDTENNFEIQGLPKLPNLLSDIFVPSLMDLFHDI 239

  Fly   119 VQSLLNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFG---------WN-KKNPDESECC 173
            :::.|.....:|.|:|||..|:|......|||.||.|...||.         |: ::...:::.|
Yeast   240 IRAFLVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFFNRCKIAMLKRWDIQREIQKAKSC 304

  Fly   174 P 174
            |
Yeast   305 P 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 35/162 (22%)
CTR1NP_015449.1 Ctr 130..281 CDD:398012 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104136
Panther 1 1.100 - - O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.