DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and CTR3

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_013515.3 Gene:CTR3 / 851129 SGDID:S000004403 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:50/248 - (20%)
Similarity:94/248 - (37%) Gaps:83/248 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHGSDDSTSTAK-SCPMIMVFHAGHCERILW---------RGWVASTVTEFVLSALAIFLVSFL 55
            |:.|...||:..| :|.:.|:::        |         |.|...|..:|..|.:..|.:..:
Yeast     1 MNMGGSSSTAAKKATCKISMLWN--------WYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVV 57

  Fly    56 YEAL-KFLRQ---QLARRE-----ARRASEQL---AAEQRRKNEAPAAGGCCSEAP--------- 99
            .:.| :|.||   :|.:|:     |..:.|:.   ..|:..|::.....|..:|..         
Yeast    58 AQWLTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKTTLISLQ 122

  Fly   100 --------------LAEPREQTYWQRLFASS-------------HIVQSLLNLLQIVISYLLMLI 137
                          |.||.:....:.|...:             |:::..:.:||..:||::||:
Yeast   123 KSFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFLDHMIRVTIFVLQWGLSYIIMLL 187

  Fly   138 FMTFNYWLCLAVILGLGLGYFFF--------GWN---------KKNPDESECC 173
            ||.:|.::.::.::|..:|.|.|        |.|         .|..|:.:||
Yeast   188 FMYYNGYIIISCLIGAIVGRFIFCYEPLGSLGANGSAQGTVSYDKESDDRKCC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 37/199 (19%)
CTR3NP_013515.3 Ctr 20..210 CDD:398012 37/197 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.