DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and COPT3

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_200712.1 Gene:COPT3 / 836021 AraportID:AT5G59040 Length:151 Species:Arabidopsis thaliana


Alignment Length:148 Identity:32/148 - (21%)
Similarity:56/148 - (37%) Gaps:48/148 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALK---FLRQQLARREARRASEQL 78
            |.|.|..|....:|:.||..:::..:.:....||::|...|.|.   |:                
plant    30 MHMTFFWGKTTEVLFDGWPGTSLKMYWVCLAVIFVISAFSECLSRCGFM---------------- 78

  Fly    79 AAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVISYLLMLIFMTFNY 143
                 :...|...||                        ::|:.:..::..:|||:||..|:||.
plant    79 -----KSGPASLGGG------------------------LLQTAVYTVRAALSYLVMLAVMSFNG 114

  Fly   144 WLCLAVILGLGLGYFFFG 161
            .:.:|.:.|.|||:..||
plant   115 GVFVAAMAGFGLGFMIFG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 30/145 (21%)
COPT3NP_200712.1 Ctr 30..131 CDD:282057 30/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.