DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and COPT1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_200711.1 Gene:COPT1 / 836020 AraportID:AT5G59030 Length:170 Species:Arabidopsis thaliana


Alignment Length:180 Identity:39/180 - (21%)
Similarity:66/180 - (36%) Gaps:60/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGSDDSTSTAKSCP---------------------MIMVFHAGHCERILWRGWVASTVTEFVLSA 46
            ||....:|::.|.|                     |.|.|..|....:|:.||..::...:.|..
plant     7 HGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCL 71

  Fly    47 LAIFLVSFLYEALKFLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQR 111
            :.:|.::.|.|       .||.....|.|...:|.:       |||                   
plant    72 IFVFFLAVLTE-------WLAHSSLLRGSTGDSANR-------AAG------------------- 103

  Fly   112 LFASSHIVQSLLNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFG 161
                  ::|:.:..|:|.::||:||..|:||..:.|..:.|..:|:..||
plant   104 ------LIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 32/142 (23%)
COPT1NP_200711.1 Ctr 45..146 CDD:367839 30/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.